PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 32466
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family GATA
Protein Properties Length: 271aa    MW: 27678.9 Da    PI: 9.8745
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
32466genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA48.89.3e-16140173134
   GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
            C+nC++t+Tp WR+++dg  +LCnaCGly +k++
  32466 140 CVNCKSTETPFWRKDKDGIGSLCNACGLYAAKNH 173
            ******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.47E-13134183No hitNo description
SMARTSM004019.1E-14134185IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.6E-18134184IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011415.973134190IPR000679Zinc finger, GATA-type
CDDcd002023.18E-15139185No hitNo description
PROSITE patternPS003440140165IPR000679Zinc finger, GATA-type
PfamPF003202.4E-13140173IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MATQAMYAQQ MMTTMTPEAM GAAYYERQNA ALAAMGPHMM ASYAAYVAYV QSQTYNVQAY  60
AGMMGASPPF SGAYGTPAMG AAAYGGEATS ARTGRGGGGA KKGGKGGRAG RKGGVTQSIR  120
ACKATVKAST NVKAQKQKIC VNCKSTETPF WRKDKDGIGS LCNACGLYAA KNHAPRPALL  180
WRRSGATGSE NGGSDKTGSD KTTEAVPSSS GDAAENKSKQ DGHTSLLKTS GSGDLTATTT  240
TTTTTTTTDS DDARIAKQEA KLDGVGRGAE *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0005870.0CP000587.1 Ostreococcus lucimarinus CCE9901 chromosome 7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001418837.10.0predicted protein
TrEMBLA4RZQ30.0A4RZQ3_
STRINGA4RZQ30.0(Ostreococcus lucimarinus CCE9901)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP41981111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.17e-08GATA transcription factor 23